Structure of PDB 4mtd Chain C

Receptor sequence
>4mtdC (length=148) Species: 83333 (Escherichia coli K-12) [Search protein sequence]
TTQELLAQAEKICAQRNVRLTPQRLEVLRLMSLQDGAISAYDLLDLLREA
EPQAKPPTVYRALDFLLEQGFVHKVESTNSYVLCHLFDQPTHTSAMFICD
RCGAVKEECAEGVEDIMHTLAAKMGFALRHNVIEAHGLCAACVEVEAC
3D structure
PDB4mtd Structural and Mechanistic Basis of Zinc Regulation Across the E. coli Zur Regulon.
ChainC
Resolution2.5 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C Y45 P61 Y64 K78 Y85 Y41 P57 Y60 K74 Y81
BS02 dna C T25 Q27 R28 K59 P61 R65 T21 Q23 R24 K55 P57 R61
BS03 ZN C C103 C106 C143 C146 C99 C102 C139 C142
BS04 ZN C H77 C88 H96 E111 H73 C84 H92 E107
Gene Ontology
Molecular Function
GO:0000976 transcription cis-regulatory region binding
GO:0001217 DNA-binding transcription repressor activity
GO:0003677 DNA binding
GO:0003700 DNA-binding transcription factor activity
GO:0008270 zinc ion binding
GO:0042802 identical protein binding
Biological Process
GO:0006351 DNA-templated transcription
GO:0006355 regulation of DNA-templated transcription
GO:0045892 negative regulation of DNA-templated transcription
GO:1900376 regulation of secondary metabolite biosynthetic process
Cellular Component
GO:0005829 cytosol
GO:0032993 protein-DNA complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4mtd, PDBe:4mtd, PDBj:4mtd
PDBsum4mtd
PubMed25369000
UniProtP0AC51|ZUR_ECOLI Zinc uptake regulation protein (Gene Name=zur)

[Back to BioLiP]