Structure of PDB 4mp0 Chain C

Receptor sequence

>4mp0C (length=291) Species: 9606 (Homo sapiens)

LNLDSIIGRLLEVQGSRPGKNVQLTENEIRGLCLKSREIFLSQPILLELE
APLKICGDIHGQYYDLLRLFEYGGFPPESNYLFLGDYVDRGKQSLETICL
LLAYKIKYPENFFLLRGNHECASINRIYGFYDECKRRYNIKLWKTFTDCF
NCLPIAAIVDEKIFCCHGGLSPDLQSMEQIRRIMRPTDVPDQGLLCDLLW
SDPDKDVQGWGENDRGVSFTFGAEVVAKFLHKHDLDLICRAHQVVEDGYE
FFAKRQLVTLFSAPNYCGEFDNAGAMMSVDETLMCSFQILK

3D structure

• PDB: 4mp0 Understanding the antagonism of retinoblastoma protein dephosphorylation by PNUTS provides insights into the PP1 regulatory code.
• Chain: C
• Resolution: 2.1003 Å

Enzymatic activity

• Enzyme Commision number: 3.1.3.16: protein-serine/threonine phosphatase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	P24 Q68 D71 R74 Y78 R96 Y134 I169 D242 Y255 F257 R261 P270 N271 C273 E275 L289 M290 C291 S292 F293 Q294 I295 L296 K297	P18 Q62 D65 R68 Y72 R90 Y128 I163 D236 Y249 F251 R255 P264 N265 C267 E269 L283 M284 C285 S286 F287 Q288 I289 L290 K291
BS02	MN	C	D64 H66 D92	D58 H60 D86
BS03	MN	C	D92 N124 H173 H248	D86 N118 H167 H242

Gene Ontology

Molecular Function

• GO:0016787 hydrolase activity

External links

• PDB: RCSB:4mp0, PDBe:4mp0, PDBj:4mp0
• PDBsum: 4mp0
• PubMed: 24591642
• UniProt: P62136|PP1A_HUMAN Serine/threonine-protein phosphatase PP1-alpha catalytic subunit (Gene Name=PPP1CA)