Structure of PDB 4mdt Chain C

Receptor sequence

>4mdtC (length=299) Species: 562 (Escherichia coli)

MIKQRTLKRIVQATGVGLHTGKKVTLTLRPAPANTGVIYRRTDLNPPVDF
PADAKSVRDTMLCTCLVNEHDVRISTVEHLNAALAGLGIDNIVIEVNAPE
IPIMDGSAAPFVYLLLDAGIDELNSAKKFVRIKETVRVEDGDKWAEFKPY
NGFSLDFTIDFNHPAIDSNQRYAMNFSADAFMRQISRARTFGFMRDIEYL
QSRGLCLGGSFDCAIVVDDYRVLNEDGLRFEDEFVRHKMLDAIGDLFMCG
HNIIGAFTAYKSGHALNNKLLQAVLAKQEAWEYVTFQDDAELPLAFKAP

3D structure

• PDB: 4mdt Structure of the Bacterial Deacetylase LpxC Bound to the Nucleotide Reaction Product Reveals Mechanisms of Oxyanion Stabilization and Proton Transfer.
• Chain: C
• Resolution: 2.59 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	H79 H238 D242	H79 H237 D241
BS02	24G	C	F161 F192 I198 G210 S211 F212 K239 K262 H265	F161 F191 I197 G209 S210 F211 K238 K261 H264

Gene Ontology

--> -->

UnboundLocalError

Python 3.6.8: /usr/bin/python3 Tue Feb 18 13:06:20 2025

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()

   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)

   1444         else:

=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)

   1446     

   1447     uniprot_line=''

pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4mdt', asym_id = 'C', title = 'Structure of the Bacterial Deacetylase LpxC Boun...s of Oxyanion Stabilization and Proton Transfer. '

 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4mdt', asym_id='C', title='Structure of the Bacterial Deacetylase LpxC Boun...s of Oxyanion Stabilization and Proton Transfer. ')

    839 

    840     if go:

=>  841         display_go(go,uniprot,pdbid,asym_id)

    842     return pubmed,uniprot

    843 

global display_go = <function display_go>, go = '0008759,0009245', uniprot = '', pdbid = '4mdt', asym_id = 'C'

 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008759,0009245', uniprot='', pdbid='4mdt', asym_id='C')

    480         '''.replace("$namespace_link",namespace_link

    481           ).replace("$namespace",namespace

=>  482           ).replace("$uniprot",u

    483         ))

    484         for l,(term,name) in enumerate(go2aspect[Aspect]):

u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>