Structure of PDB 4m9z Chain C

Receptor sequence
>4m9zC (length=510) Species: 6239 (Caenorhabditis elegans) [Search protein sequence]
MLCEIECRALSTAHTRLIHDFEPRDALTYLEGKNIFTEDHSELISKMSTR
LERIANFLRIYRRQASELGPLIDFFNYNNQSHLADFLEDYIDFAINEPDL
LRPVVIAPQFSRQMLDRKLLLGNVPKQMTCYIREYHVDRVIKKLDEMCDL
DSFFLFLHGRAGSGKSVIASQALSKSDQLIGINYDSIVWLKDSGTAPKST
FDLFTDILLMLKSEDDLLNFPSVEHVTSVVLKRMICNALIDRPNTLFVFD
DVVQEETIRWAQELRLRCLVTTRDVEISNAASQTCEFIEVTSLEIDECYD
FLEAYGMPMPVGEKEEDVLNKTIELSSGNPATLMMFFKSCEPKTFEKMAQ
LNNKLESRGLVGVECITPYSYKSLAMALQRCVEVLSDEDRSALAFAVVMP
PGVDIPVKLWSCVIPVDEQLDDEVADRLKRLSKRGALLSGKRMPVLTFKI
DHIIHMFLKHVVDAQTIANGISILEQRLLEIETVIRPEDFPKFMQLHQKF
YDSLKNFACC
3D structure
PDB4m9z Mechanistic insights into CED-4-mediated activation of CED-3.
ChainC
Resolution3.405 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C Q379 V382 E383 R390 A394 V467 V468 D469 Q379 V382 E383 R390 A394 V461 V462 D463
BS02 ATP C M128 Y131 G162 G164 K165 S166 V167 R273 F301 P330 A331 P368 Y369 M128 Y131 G162 G164 K165 S166 V167 R273 F301 P330 A331 P368 Y369
Gene Ontology
Molecular Function
GO:0000287 magnesium ion binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0008656 cysteine-type endopeptidase activator activity involved in apoptotic process
GO:0016505 peptidase activator activity involved in apoptotic process
GO:0042802 identical protein binding
GO:0043531 ADP binding
GO:0046872 metal ion binding
GO:0051432 BH1 domain binding
GO:0051434 BH3 domain binding
GO:0061133 endopeptidase activator activity
GO:0089720 caspase binding
Biological Process
GO:0006915 apoptotic process
GO:0006919 activation of cysteine-type endopeptidase activity involved in apoptotic process
GO:0008361 regulation of cell size
GO:0009792 embryo development ending in birth or egg hatching
GO:0010954 positive regulation of protein processing
GO:0030042 actin filament depolymerization
GO:0030155 regulation of cell adhesion
GO:0031647 regulation of protein stability
GO:0040034 regulation of development, heterochronic
GO:0042981 regulation of apoptotic process
GO:0043065 positive regulation of apoptotic process
GO:0046716 muscle cell cellular homeostasis
GO:0048598 embryonic morphogenesis
GO:0050829 defense response to Gram-negative bacterium
GO:0097202 activation of cysteine-type endopeptidase activity
GO:1900118 negative regulation of execution phase of apoptosis
GO:1902742 apoptotic process involved in development
GO:1904747 positive regulation of apoptotic process involved in development
GO:1905808 positive regulation of synapse pruning
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005739 mitochondrion
GO:0005829 cytosol
GO:0008303 caspase complex
GO:0016020 membrane
GO:0032991 protein-containing complex
GO:0048471 perinuclear region of cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4m9z, PDBe:4m9z, PDBj:4m9z
PDBsum4m9z
PubMed24065769
UniProtP30429|CED4_CAEEL Cell death protein 4 (Gene Name=ced-4)

[Back to BioLiP]