Structure of PDB 4ko6 Chain C |
>4ko6C (length=128) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAITVDKSCKQFTINLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSKTFDVS KLKEGEQFMFFCTFPGHSALMKGTLTLK |
|
PDB | 4ko6 Investigating the functional significance of the interlocked pair structural determinants in Pseudomonas aeruginosa azurin (V31I/V95K/Y108F) |
Chain | C |
Resolution | 1.738 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
G45 H46 C112 H117 |
G45 H46 C112 H117 |
|
|
|
|