Structure of PDB 4k8n Chain C

Receptor sequence
>4k8nC (length=206) Species: 9606 (Homo sapiens) [Search protein sequence]
NLKVVLVSFKQCLDEKEEVLLDPYIASWKGLVRFLNSLGTIFSFISKDVV
SKLRIMERLRGGPQSEHYRSLQAMVAHELSNRLVDLERRSHHPESGCRTV
LRLHRALHWLQLFLEGLRTSPEDARTSALCADSYNASLAAYHPWVVRRAV
TVAFCTLPTREVFLEAMNVGPPEQAVQMLGEALPFIQRVYNVSQKLYAEH
SLLDLP
3D structure
PDB4k8n Non-vesicular trafficking by a ceramide-1-phosphate transfer protein regulates eicosanoids.
ChainC
Resolution3.102 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 1Q0 C W36 L39 F42 F50 I53 D56 K60 R106 R110 W117 L118 Y142 H150 V158 L165 W28 L31 F34 F42 I45 D48 K52 R98 R102 W109 L110 Y134 H142 V150 L157
Gene Ontology
Molecular Function
GO:0005543 phospholipid binding
GO:0008289 lipid binding
GO:0120013 lipid transfer activity
GO:1902387 ceramide 1-phosphate binding
GO:1902388 ceramide 1-phosphate transfer activity
Biological Process
GO:0006869 lipid transport
GO:0010507 negative regulation of autophagy
GO:0032691 negative regulation of interleukin-1 beta production
GO:0035627 ceramide transport
GO:0046836 glycolipid transport
GO:0120009 intermembrane lipid transfer
GO:1900226 negative regulation of NLRP3 inflammasome complex assembly
GO:1902389 ceramide 1-phosphate transport
Cellular Component
GO:0005634 nucleus
GO:0005640 nuclear outer membrane
GO:0005737 cytoplasm
GO:0005768 endosome
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0010008 endosome membrane

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4k8n, PDBe:4k8n, PDBj:4k8n
PDBsum4k8n
PubMed23863933
UniProtQ5TA50|CPTP_HUMAN Ceramide-1-phosphate transfer protein (Gene Name=CPTP)

[Back to BioLiP]