Structure of PDB 4jws Chain C

Receptor sequence

>4jwsC (length=106) Species: 303 (Pseudomonas putida)

SKVVYVSHDGTRRELDVADGVSLMQAAVSNGIYDIVGDCGGSASCATCHV
YVNEAFTDKVPAANEREIGMLECVTAELKPNSRLCCQIIMTPELDGIVVD
VPDRQW

3D structure

• PDB: 4jws Structural basis for effector control and redox partner recognition in cytochrome P450.
• Chain: C
• Resolution: 2.15 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	1N0	C	M70 C73	M70 C73
BS02	FES	C	G37 C39 G41 A43 S44 C45 C48 C86	G37 C39 G41 A43 S44 C45 C48 C86

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0046872 metal ion binding
• GO:0051536 iron-sulfur cluster binding
• GO:0051537 2 iron, 2 sulfur cluster binding

Biological Process

• GO:0140647 P450-containing electron transport chain

Cellular Component

• GO:0005829 cytosol

External links

• PDB: RCSB:4jws, PDBe:4jws, PDBj:4jws
• PDBsum: 4jws
• PubMed: 23744947
• UniProt: P00259|PUTX_PSEPU Putidaredoxin (Gene Name=camB)