Structure of PDB 4jqo Chain C

Receptor sequence

>4jqoC (length=334) Species: 216895 (Vibrio vulnificus CMCP6)

MAFNLRNRNFLKLLDFSTKEIQFLIDLSADLKKAKYAGTEQKKLLGKNIA
LIFEKASTRTRCAFEVAAFDQGAQVTYIGPSGSQIGDKESMKDTARVLGR
MYDGIQYRGFGQAIVEELGAFAGVPVWNGLTDEFHPTQILADFLTMLEHS
QGKALADIQFAYLGDARNNVGNSLMVGAAKMGMDIRLVGPQAYWPDEELV
AACQAIAKQTGGKITLTENVAEGVQGCDFLYTDVWVSMGESPEAWDERVA
LMKPYQVNMNVLKQTGNPNVKFMHCLPAFHNDETTIGKQVADKFGMKGLE
VTEEVFESEHSIVFDEAENRMHTIKAVMVATLGS

3D structure

• PDB: 4jqo Crystal structures and kinetic properties of anabolic ornithine carbamoyltransferase from human pathogens Vibrio vulnificus and Bacillus anthracis
• Chain: C
• Resolution: 2.082 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R59 T60 D87 R108 H135 Q138 D233 C275 R320
• Catalytic site (residue number reindexed from 1): R59 T60 D87 R108 H135 Q138 D233 C275 R320
• Enzyme Commision number: 2.1.3.3: ornithine carbamoyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	CIR	C	L130 H135 Q138 N169 D233 S237 M238 C275 L276 R320	L130 H135 Q138 N169 D233 S237 M238 C275 L276 R320

Gene Ontology

Molecular Function

• GO:0004585 ornithine carbamoyltransferase activity
• GO:0016597 amino acid binding
• GO:0016740 transferase activity
• GO:0016743 carboxyl- or carbamoyltransferase activity

Biological Process

• GO:0006520 amino acid metabolic process
• GO:0006526 L-arginine biosynthetic process
• GO:0006591 ornithine metabolic process
• GO:0019240 citrulline biosynthetic process
• GO:0042450 arginine biosynthetic process via ornithine

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4jqo, PDBe:4jqo, PDBj:4jqo
• PDBsum: 4jqo
• UniProt: Q8DCF5|OTC_VIBVU Ornithine carbamoyltransferase (Gene Name=argF)