Structure of PDB 4jlw Chain C

Receptor sequence
>4jlwC (length=395) Species: 557722 (Pseudomonas aeruginosa LESB58) [Search protein sequence]
GNRGVVYLGPGKVEVQNIPYPKMQDPQGRQIDHGVILRVVSTNICGSDQH
MVRGRTTAPEGLVLGHEITGEVVEIGRGVETMKIGDLVSVPFNVACGHCR
TCKEQHTGVCLTVNPARAGGAYGYVDMGGWVGGQAEYVLVPYADFNLLKL
PNREAAMEKIRDLTCLSDILPTGYHGAVTAGVGPGSTVYIAGAGPVGLAA
AASARLLGAAVVIVGDVNPTRLAHAKKQGFEIADLSKDTPLHEQIAALLG
EPEVDCAVDAVGFEARGHGHSGSQQEAPATVLNSLMGITRVAGKIGIPGL
YVTEDPGAVDAAAKHGALSIRFGLGWAKSHSFHTGQTPVMKYNRQLMQAI
MWDRIKIADIVGVEVITLDDAPKGYGEFDAGVPKKFVIDPHNLFR
3D structure
PDB4jlw Structure of formaldehyde dehydrogenase from Pseudomonas aeruginosa: the binary complex with the cofactor NAD+.
ChainC
Resolution2.7 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ZN C C98 C101 C104 C112 C96 C99 C102 C110
BS02 ZN C C47 H68 D170 C45 H66 D168
BS03 NAD C S49 H52 T174 G194 G196 V198 G217 D218 R223 A262 V263 R268 H270 V283 P300 G301 L302 T339 S47 H50 T172 G192 G194 V196 G215 D216 R221 A260 V261 R266 H268 V281 P298 G299 L300 T337
Gene Ontology
--> -->
 
 
UnboundLocalError		Python 3.6.8: /usr/bin/python3
Sat Nov 16 20:58:54 2024

A problem occurred in a Python script. Here is the sequence of function calls leading up to the error, in the order they occurred.

 /var/www/html/BioLiP/pdb.cgi in <module>()
   1443                 pubmed=display_regular_ligand(pdbid,asym_id,lig3,ligIdx,title)
   1444         else:
=> 1445             pubmed,uniprot=display_protein_receptor(pdbid,asym_id,title)
   1446     
   1447     uniprot_line=''
pubmed = '', uniprot = '', display_protein_receptor = <function display_protein_receptor>, pdbid = '4jlw', asym_id = 'C', title = 'Structure of formaldehyde dehydrogenase from Pse...inosa: the binary complex with the cofactor NAD+.'
 /var/www/html/BioLiP/pdb.cgi in display_protein_receptor(pdbid='4jlw', asym_id='C', title='Structure of formaldehyde dehydrogenase from Pse...inosa: the binary complex with the cofactor NAD+.')
    839 
    840     if go:
=>  841         display_go(go,uniprot,pdbid,asym_id)
    842     return pubmed,uniprot
    843 
global display_go = <function display_go>, go = '0008270,0016491', uniprot = '', pdbid = '4jlw', asym_id = 'C'
 /var/www/html/BioLiP/pdb.cgi in display_go(go='0008270,0016491', uniprot='', pdbid='4jlw', asym_id='C')
    480         '''.replace("$namespace_link",namespace_link
    481           ).replace("$namespace",namespace
=>  482           ).replace("$uniprot",u
    483         ))
    484         for l,(term,name) in enumerate(go2aspect[Aspect]):
u undefined

UnboundLocalError: local variable 'u' referenced before assignment
      args = ("local variable 'u' referenced before assignment",)
      with_traceback = <built-in method with_traceback of UnboundLocalError object>