Structure of PDB 4jd3 Chain C

Receptor sequence

>4jd3C (length=352) Species: 1773 (Mycobacterium tuberculosis)

SVIAGVFGALPPHRYSQSEITDSFVEFPGLKEHEEIIRRLHAAAKVNGRH
LVLPLQQYPSLTDFGDANEIFIEKAVDLGVEALLGALDDANLRPSDIDMI
ATATVTGVAVPSLDARIAGRLGLRPDVRRMPLFGLGSVAGAAGVARLRDY
LRGAPDDVAVLVSVELCSLTYPAVKPTVSSLVGTALFGDGAAAVVAVGDR
RAEQVRAGGPDILDSRSSLYPDSLHIMGWDVGSHGLRLRLSPDLTNLIER
YLANDVTTFLDAHRLTKDDIGAWVSHPGGPKVIDAVATSLALPPEALELT
WRSLGEIGNLSSASILHILRDTIEKRPPSGSAGLMLAMGPGFCTELVLLR
WR

3D structure

• PDB: 4jd3 Crystal structure of Mycobacterium tuberculosis polyketide synthase 11 (PKS11) reveals intermediates in the synthesis of methyl-branched alkylpyrones.
• Chain: C
• Resolution: 2.25 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): S138 F188 H277 N310
• Catalytic site (residue number reindexed from 1): S137 F187 H276 N309
• Enzyme Commision number: 2.3.1.-

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	COA	C	A44 V179 L241 L245 G279 P281 K282 V283 M339	A43 V178 L240 L244 G278 P280 K281 V282 M338

Gene Ontology

Molecular Function

• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups

Biological Process

• GO:0006631 fatty acid metabolic process
• GO:0006633 fatty acid biosynthetic process
• GO:0008610 lipid biosynthetic process
• GO:0009058 biosynthetic process
• GO:0009715 chalcone biosynthetic process
• GO:0030639 polyketide biosynthetic process
• GO:0071770 DIM/DIP cell wall layer assembly

Cellular Component

• GO:0034081 polyketide synthase complex

External links

• PDB: RCSB:4jd3, PDBe:4jd3, PDBj:4jd3
• PDBsum: 4jd3
• PubMed: 23615910
• UniProt: P9WPF3|PKS11_MYCTU Methyl-branched alkylpyrone synthesis polyketide synthase-like Pks11 (Gene Name=pks11)