Structure of PDB 4izm Chain C

Receptor sequence

>4izmC (length=404) Species: 70601 (Pyrococcus horikoshii OT3)

LQKILIGLILGAIVGLILGHYGYAHAVHTYVKPFGDLFVRLLKMLVMPIV
FASCVVGAASISPARLGRVGVKIVVYYLLTSAFAVTLGIIMARLFNPGAG
IHLAVGGQQFQPHQAPPLVHILLDIVPTNPFGALANGQVLPTIFFAIILG
IAITYLMNSENEKVRKSAETLLDAINGLAEAMYKIVNGVMQYAPIGVFAL
IAYVMAEQGVHVVGELAKVTAAVYVGLTLQILLVYFVLLKIYGIDPISFI
KHAKDAMLTAFVTRSSSGTLPVTMRVAKEMGISEGIYCFTLPLGATINMD
GTALYQGVATFFIANALGSHLTVGQQLTIVLTAVLASIGTAGVPGAGAIM
LAMVLHSVGLPLTDPNVAAAYAMILGIDAILDMGRTMVNVTGDLTGTAIV
AKTE

3D structure

• PDB: 4izm Binding thermodynamics of a glutamate transporter homolog.
• Chain: C
• Resolution: 4.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NA	C	T308 M311 S349 I350 G351 T352	T296 M299 S337 I338 G339 T340
BS02	NA	C	G306 A307 N310 M311 N401 D405	G294 A295 N298 M299 N389 D393
BS03	ASP	C	R276 S278 M311 T314 G354 G359 D394 R397 T398 N401	R264 S266 M299 T302 G342 G347 D382 R385 T386 N389

Gene Ontology

Molecular Function

• GO:0005283 amino acid:sodium symporter activity
• GO:0015108 chloride transmembrane transporter activity
• GO:0015183 L-aspartate transmembrane transporter activity
• GO:0015293 symporter activity
• GO:0015501 glutamate:sodium symporter activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0006865 amino acid transport
• GO:0035725 sodium ion transmembrane transport
• GO:0046942 carboxylic acid transport
• GO:0070207 protein homotrimerization
• GO:0070778 L-aspartate transmembrane transport
• GO:0140009 L-aspartate import across plasma membrane
• GO:1902476 chloride transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:4izm, PDBe:4izm, PDBj:4izm
• PDBsum: 4izm
• PubMed: 23563139
• UniProt: O59010|GLT_PYRHO Glutamate transporter homolog (Gene Name=PH1295)