Structure of PDB 4iro Chain C

Receptor sequence

>4iroC (length=142) Species: 40690 (Trematomus bernacchii)

SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVT
PGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPANFK
ILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR

3D structure

• PDB: 4iro Role of tertiary structures on the Root effect in fish hemoglobins.
• Chain: C
• Resolution: 2.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y42 H45 W46 H59 K62 V63 G66 L84 Q87 H88 L92 N98 F99 L102	Y42 H45 W46 H59 K62 V63 G66 L84 Q87 H88 L92 N98 F99 L102

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:4iro, PDBe:4iro, PDBj:4iro
• PDBsum: 4iro
• PubMed: 23376186
• UniProt: P80043|HBA_TREBE Hemoglobin subunit alpha (Gene Name=hba)