Structure of PDB 4ihg Chain C

Receptor sequence

>4ihgC (length=332) Species: 83333 (Escherichia coli K-12)

SIRLADLAQQLDAELHGDGDIVITGVASMQSAQTGHITFMVNPKYREHLG
LCQASAVVMTQDDLPFAKSAALVVKNPYLTYARMAQILDTTPQPAQNIAP
SAVIDATAKLGNNVSIGANAVIESGVELGDNVIIGAGCFVGKNSKIGAGS
RLWANVTIYHEIQIGQNCLIQSGTVVGADGFGYANDRGNWVKIPQIGRVI
IGDRVEIGACTTIDRGALDDTIIGNGVIIDNQCQIAHNVVIGDNTAVAGG
VIMAGSLKIGRYCMIGGASVINGHMEICDKVTVTGMGMVMRPITEPGVYS
SGIPLQPNKVWRKTAALVMNIDDMSKRLKSLE

3D structure

• PDB: 4ihg Chasing acyl carrier protein through a catalytic cycle of lipid A production.
• Chain: C
• Resolution: 2.89 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H239 N240 G257
• Catalytic site (residue number reindexed from 1): H237 N238 G255
• Enzyme Commision number: 2.3.1.191: UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	PNS	C	N310 R314	N308 R312

Gene Ontology

Molecular Function

• GO:0005515 protein binding
• GO:0016410 N-acyltransferase activity
• GO:0016740 transferase activity
• GO:0016746 acyltransferase activity
• GO:0016747 acyltransferase activity, transferring groups other than amino-acyl groups
• GO:0042802 identical protein binding
• GO:0103118 UDP-3-O-(R-3-hydroxymyristoyl)-glucosamine N-acyltransferase activity

Biological Process

• GO:0009245 lipid A biosynthetic process
• GO:0046677 response to antibiotic

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4ihg, PDBe:4ihg, PDBj:4ihg
• PDBsum: 4ihg
• PubMed: 24196711
• UniProt: P21645|LPXD_ECOLI UDP-3-O-(3-hydroxymyristoyl)glucosamine N-acyltransferase (Gene Name=lpxD)