Structure of PDB 4iaw Chain C

Receptor sequence

>4iawC (length=172) Species: 9606 (Homo sapiens)

DLIPAPPLSKVPLQQNFQDNQFHGKWYQVGRAGNAAPREDKDLLKMTAQT
YELKEDKSYNVTAVRFRKKMCEYLTMTFVPGSQPGEFTLGNIKSYPGLTS
YLVRVVSTNYNQHAMVFFKKVQQNREYFSISLLGRTKELASELKENFIRF
SKSLGLPENHIVFPVPIDQCID

3D structure

• PDB: 4iaw Structure-guided engineering of Anticalins with improved binding behavior and biochemical characteristics for application in radio-immuno imaging and/or therapy
• Chain: C
• Resolution: 2.4 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	LIZ	C	Q33 T52 Q54 V66 A68 R70 E77 L79 M81 F83 Y106 F123 S136	Q28 T47 Q49 V61 A63 R65 E72 L74 M76 F78 Y101 F118 S131	MOAD: Kd=0.234nM

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0005515 protein binding
• GO:0036094 small molecule binding
• GO:0042802 identical protein binding
• GO:0140315 iron ion sequestering activity
• GO:1903981 enterobactin binding

Biological Process

• GO:0006826 iron ion transport
• GO:0006915 apoptotic process
• GO:0015891 siderophore transport
• GO:0042742 defense response to bacterium
• GO:0045087 innate immune response
• GO:0120162 positive regulation of cold-induced thermogenesis

Cellular Component

• GO:0005576 extracellular region
• GO:0005615 extracellular space
• GO:0031410 cytoplasmic vesicle
• GO:0035580 specific granule lumen
• GO:0060205 cytoplasmic vesicle lumen
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:4iaw, PDBe:4iaw, PDBj:4iaw
• PDBsum: 4iaw
• PubMed: 23542582
• UniProt: P80188|NGAL_HUMAN Neutrophil gelatinase-associated lipocalin (Gene Name=LCN2)