Structure of PDB 4i8x Chain C

Receptor sequence

>4i8xC (length=331) Species: 9986 (Oryctolagus cuniculus)

AALKDQLIHNLLKEEHVPQNKITVVGVGAVGMACAISILMKDLADELALV
DVMEDKLKGEMMDLQHGSLFLRTPKIVSGKDYSVTANSKLVIITAGARQQ
EGESRLNLVQRNVNIFKFIIPNVVKYSPHCKLLVVSNPVDILTYVAWKIS
GFPKNRVIGSGCNLDSARFRYLMGERLGVHALSCHGWILGEHGDSSVPVW
SGMNVAGVSLKTLHPELGTDADKEQWKQVHKQVVDSAYEVIKLKGYTTWA
IGLSVADLAESIMKNLRRVHPISTMLKGLYGIKEDVFLSVPCVLGQNGIS
DVVKVTLTSEEEAHLKKSADTLWGIQKELQF

3D structure

• PDB: 4i8x Fragment growing and linking lead to novel nanomolar lactate dehydrogenase inhibitors.
• Chain: C
• Resolution: 2.23 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): R105 D165 R168 H192
• Catalytic site (residue number reindexed from 1): R105 D165 R168 H192
• Enzyme Commision number: 1.1.1.27: L-lactate dehydrogenase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	6P3	C	V30 T94 R98 V135 N137 R168 T247	V30 T94 R98 V135 N137 R168 T247	MOAD: Kd=2300uM PDBbind-CN: -logKd/Ki=2.64,Kd=2.3mM

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004459 L-lactate dehydrogenase activity
• GO:0016491 oxidoreductase activity
• GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor

Biological Process

• GO:0006089 lactate metabolic process
• GO:0006090 pyruvate metabolic process
• GO:0019752 carboxylic acid metabolic process

Cellular Component

• GO:0005737 cytoplasm

External links

• PDB: RCSB:4i8x, PDBe:4i8x, PDBj:4i8x
• PDBsum: 4i8x
• PubMed: 23302067
• UniProt: P13491|LDHA_RABIT L-lactate dehydrogenase A chain (Gene Name=LDHA)