Structure of PDB 4i7z Chain C

Receptor sequence

>4i7zC (length=288) Species: 83541 (Mastigocladus laminosus) [Search protein sequence]

YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVV
KIPYDTKLQQVAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGD
VYFQPYKEGQDNVLLVGPLPGEQYQEIVFPVLSPNPTTDKNIHFGKYAIH
LGANRGRGQIYPTGEKSNNNVFTASATGTITKIAKEEDEYGNVKYQVSIQ
TDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGFGQDDTEIVLQ
DPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAEMN

3D structure

PDB

4i7z Lipid-induced conformational changes within the cytochrome b6f complex of oxygenic photosynthesis.

Chain

Resolution

2.803 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	peptide	C	C263 M266 L270	C263 M266 L270
BS02	peptide	C	Q38 I262 M266 Q269 L270 I273 K276 K277	Q38 I262 M266 Q269 L270 I273 K276 K277
BS03	HEM	C	Y1 P2 W4 A5 C22 C25 H26 L70 N71 V72 G73 A74 N154 G156 R157 G158 I160 Y161	Y1 P2 W4 A5 C22 C25 H26 L70 N71 V72 G73 A74 N154 G156 R157 G158 I160 Y161
BS04	OZ2	C	R254 W257 F261	R254 W257 F261

Gene Ontology

	Molecular Function
GO:0005506	iron ion binding
GO:0009055	electron transfer activity
GO:0020037	heme binding
GO:0046872	metal ion binding

	Biological Process
GO:0015979	photosynthesis

	Cellular Component
GO:0009579	thylakoid
GO:0016020	membrane
GO:0031676	plasma membrane-derived thylakoid membrane
GO:0042651	thylakoid membrane

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4i7z, PDBe:4i7z, PDBj:4i7z
PDBsum	4i7z
PubMed	23514009
UniProt	P83793\|CYF_MASLA Cytochrome f (Gene Name=petA)

[Back to BioLiP]