Structure of PDB 4ht6 Chain C

Receptor sequence

>4ht6C (length=86) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]

STPIVKASDITDKLKEDILTISKDALDKYQLERDIAGTVKKQLDVKYGNT
WHVIVGKNFGSYVTHEKGHFVYFYIGPLAFLVFKTA

3D structure

PDB

4ht6 The yeast dynein Dyn2-Pac11 complex is a dynein dimerization/processivity factor: structural and single-molecule characterization.

Chain

Resolution

1.9 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	E38 R39	E32 R33
BS02	peptide	C	K12 K63 N64 F65 G66 S67 Y68 V69 T70 H71 K73 F76 Y78 Y80	K6 K57 N58 F59 G60 S61 Y62 V63 T64 H65 K67 F70 Y72 Y74

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008574	plus-end-directed microtubule motor activity
GO:0045505	dynein intermediate chain binding

	Biological Process
GO:0000132	establishment of mitotic spindle orientation
GO:0006913	nucleocytoplasmic transport
GO:0007017	microtubule-based process
GO:0015031	protein transport
GO:0030473	nuclear migration along microtubule
GO:0040001	establishment of mitotic spindle localization
GO:0051028	mRNA transport
GO:0051292	nuclear pore complex assembly

	Cellular Component
GO:0005634	nucleus
GO:0005635	nuclear envelope
GO:0005643	nuclear pore
GO:0005737	cytoplasm
GO:0005856	cytoskeleton
GO:0005868	cytoplasmic dynein complex
GO:0005874	microtubule
GO:0005875	microtubule associated complex
GO:0005881	cytoplasmic microtubule
GO:0015630	microtubule cytoskeleton
GO:0030286	dynein complex
GO:0034399	nuclear periphery
GO:1990429	peroxisomal importomer complex

External links

PDB	RCSB:4ht6, PDBe:4ht6, PDBj:4ht6
PDBsum	4ht6
PubMed	23761070
UniProt	Q02647\|DYL1_YEAST Dynein light chain 1, cytoplasmic (Gene Name=DYN2)