Structure of PDB 4hfd Chain C

Receptor sequence

>4hfdC (length=311) Species: 251221 (Gloeobacter violaceus PCC 7421)

VSPPPPIADEPLTVNTGIYLIECYSLDDKAETFKVNAFLSLSWKDRRLAF
DPVRSGVRVKTYEPEAIWIPEIRFVNVENARDADVVDISVSPDGTVQYLE
RFSARVLSPLDFRRYPFDSQTLHIYLIVRSVDTRNIVLAVDLEKVGKNDD
VFLTGWDIESFTAVVKPANFALEDRLESKLDYQLRISRQYFSYIPNIILP
MLFILFISWTAFWSTSYEANVTLVVSTLIAHIAANILVETNLPKTPYMTY
TGAIIFMIYLFYFVAVIEVTVQHYLKVESQPARAASITRASRIAFPVVFL
LANIILAFLFF

3D structure

• PDB: 4hfd Structural basis for potentiation by alcohols and anaesthetics in a ligand-gated ion channel.
• Chain: C
• Resolution: 3.1 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	MBR	C	I236 N239	I232 N235
BS02	MBR	C	Y119 Y197 I201 L241 V242 N245	Y115 Y193 I197 L237 V238 N241
BS03	MBR	C	P120 Y197 I201 I202 V242 T255	P116 Y193 I197 I198 V238 T251
BS04	MBR	C	N200 A238	N196 A234

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0005267 potassium channel activity
• GO:0005272 sodium channel activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0006814 sodium ion transport
• GO:0034220 monoatomic ion transmembrane transport
• GO:0035725 sodium ion transmembrane transport
• GO:0071805 potassium ion transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane
• GO:1902495 transmembrane transporter complex

External links

• PDB: RCSB:4hfd, PDBe:4hfd, PDBj:4hfd
• PDBsum: 4hfd
• PubMed: 23591864
• UniProt: Q7NDN8|GLIC_GLOVI Proton-gated ion channel (Gene Name=glvI)