Structure of PDB 4h0l Chain C

Receptor sequence

>4h0lC (length=286) Species: 83541 (Mastigocladus laminosus)

YPFWAQQTYPPTPREPTGRIVCANCHLAAKPAEVEVPQSVLPDTVFKAVV
KIPYDTKLQQVAADGSKVGLNVGAVLMLPEGFKIAPEERIPEELKKEVGD
VYFQPYKEGQDNVLLVGPLPGEQYQEIVFPVLSPNPTTDKNIHFGKYAIH
LGANRGRGQIYPTGEKSNNNVFTASATGTITKIAKEEDEYGNVKYQVSIQ
TDSGKTVVDTIPAGPELIVSEGQAVKAGEALTNNPNVGGFGQDDTEIVLQ
DPNRVKWMIAFICLVMLAQLMLILKKKQVEKVQAAE

3D structure

• PDB: 4h0l Quinone-dependent proton transfer pathways in the photosynthetic cytochrome b6f complex
• Chain: C
• Resolution: 3.25 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	peptide	C	Q38 L41 V255 I259 I262 M266 Q269 L270 I273 K276 K277	Q38 L41 V255 I259 I262 M266 Q269 L270 I273 K276 K277
BS02	HEM	C	Y1 P2 W4 A5 C22 C25 H26 L70 N71 V72 G73 A74 N154 G156 R157 G158 I160 Y161	Y1 P2 W4 A5 C22 C25 H26 L70 N71 V72 G73 A74 N154 G156 R157 G158 I160 Y161

Gene Ontology

Molecular Function

• GO:0005506 iron ion binding
• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015979 photosynthesis

Cellular Component

• GO:0009579 thylakoid
• GO:0016020 membrane
• GO:0031676 plasma membrane-derived thylakoid membrane
• GO:0042651 thylakoid membrane

External links

• PDB: RCSB:4h0l, PDBe:4h0l, PDBj:4h0l
• PDBsum: 4h0l
• PubMed: 23440205
• UniProt: P83793|CYF_MASLA Cytochrome f (Gene Name=petA)