Structure of PDB 4gnk Chain C

Receptor sequence
>4gnkC (length=321) Species: 10090 (Mus musculus) [Search protein sequence]
DARRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIF
TAMQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFENPYVDAIKS
LWNDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVRV
PTTGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSE
YDQVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIM
YSHLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDT
ENIRFVFAAVKDTILQLNLKE
3D structure
PDB4gnk Full-length G alpha (q)-phospholipase C-beta 3 structure reveals interfaces of the C-terminal coiled-coil domain.
ChainC
Resolution4.0 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E49 T54 R183 D205 Q209
Catalytic site (residue number reindexed from 1) E15 T20 R149 D171 Q175
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP C E49 G51 K52 S53 T54 R181 R183 K275 D277 L278 C330 A331 T332 E15 G17 K18 S19 T20 R147 R149 K241 D243 L244 C296 A297 T298
BS02 ALF C G48 K52 R183 P185 T186 G208 Q209 G14 K18 R149 P151 T152 G174 Q175
BS03 MG C S53 T186 S19 T152
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0030234 enzyme regulator activity
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0046872 metal ion binding
GO:0047391 alkylglycerophosphoethanolamine phosphodiesterase activity
Biological Process
GO:0001501 skeletal system development
GO:0001508 action potential
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007207 phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway
GO:0007215 glutamate receptor signaling pathway
GO:0007507 heart development
GO:0008217 regulation of blood pressure
GO:0009791 post-embryonic development
GO:0010543 regulation of platelet activation
GO:0016322 neuron remodeling
GO:0021884 forebrain neuron development
GO:0032024 positive regulation of insulin secretion
GO:0042711 maternal behavior
GO:0042733 embryonic digit morphogenesis
GO:0045634 regulation of melanocyte differentiation
GO:0048066 developmental pigmentation
GO:0060158 phospholipase C-activating dopamine receptor signaling pathway
GO:0086100 endothelin receptor signaling pathway
GO:0099105 ion channel modulating, G protein-coupled receptor signaling pathway
GO:1904888 cranial skeletal system development
GO:1990806 ligand-gated ion channel signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005794 Golgi apparatus
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030425 dendrite
GO:0031965 nuclear membrane
GO:0044297 cell body
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4gnk, PDBe:4gnk, PDBj:4gnk
PDBsum4gnk
PubMed23377541
UniProtP21279|GNAQ_MOUSE Guanine nucleotide-binding protein G(q) subunit alpha (Gene Name=Gnaq)

[Back to BioLiP]