Structure of PDB 4gkk Chain C

Receptor sequence

>4gkkC (length=206) Species: 300852 (Thermus thermophilus HB8)

GNKIHPIGFRLGITRDWESRWYAGKKQYRHLLLEDQRIRGLLEKELYSAG
LARVDIERAADNVAVTVHVAKPGVVIGRGGERIRVLREELAKLTGKNVAL
NVQEVQNPNLSAPLVAQRVAEQIERRFAVRRAIKQAVQRVMESGAKGAKV
IVSGRIGGAEQARTEWAAQGRVPLHTLRANIDYGFALARTTYGVLGVKAY
IFLGEV

3D structure

• PDB: 4gkk Expanded use of sense codons is regulated by modified cytidines in tRNA.
• Chain: C
• Resolution: 3.2 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	rna	C	G2 N3 K4 I5 F10 I14 K26 R127 S154 R156 E161 Q162 A163 W167 R172 V173 L175 H176 T177 L178 R179 R190 T192 Y193 G194 V195 G197 K199	G1 N2 K3 I4 F9 I13 K25 R126 S153 R155 E160 Q161 A162 W166 R171 V172 L174 H175 T176 L177 R178 R189 T191 Y192 G193 V194 G196 K198

Gene Ontology

Molecular Function

• GO:0003676 nucleic acid binding
• GO:0003723 RNA binding
• GO:0003735 structural constituent of ribosome

Biological Process

• GO:0006412 translation

External links

• PDB: RCSB:4gkk, PDBe:4gkk, PDBj:4gkk
• PDBsum: 4gkk
• PubMed: 23781103
• UniProt: P80372|RS3_THET8 Small ribosomal subunit protein uS3 (Gene Name=rpsC)