Structure of PDB 4g51 Chain C

Receptor sequence

>4g51C (length=142) Species: 40690 (Trematomus bernacchii)

SLSDKDKAAVRALWSKIGKSADAIGNDALSRMIVVYPQTKTYFSHWPDVT
PGSPHIKAHGKKVMGGIALAVSKIDDLKTGLMELSEQHAYKLRVDPANFK
ILNHCILVVISTMFPKEFTPEAHVSLDKFLSGVALALAERYR

3D structure

• PDB: 4g51 Selective X-ray-induced NO photodissociation in haemoglobin crystals: evidence from a Raman-assisted crystallographic study.
• Chain: C
• Resolution: 2.5 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	Y42 F43 W46 H59 K62 V63 Q87 H88 L92 V94 N98 F99 L102	Y42 F43 W46 H59 K62 V63 Q87 H88 L92 V94 N98 F99 L102

Gene Ontology

Molecular Function

• GO:0004601 peroxidase activity
• GO:0005344 oxygen carrier activity
• GO:0005506 iron ion binding
• GO:0019825 oxygen binding
• GO:0020037 heme binding
• GO:0031720 haptoglobin binding
• GO:0043177 organic acid binding
• GO:0046872 metal ion binding

Biological Process

• GO:0015671 oxygen transport
• GO:0042744 hydrogen peroxide catabolic process
• GO:0098869 cellular oxidant detoxification

Cellular Component

• GO:0005833 hemoglobin complex
• GO:0031838 haptoglobin-hemoglobin complex
• GO:0072562 blood microparticle

External links

• PDB: RCSB:4g51, PDBe:4g51, PDBj:4g51
• PDBsum: 4g51
• PubMed: 23275172
• UniProt: P80043|HBA_TREBE Hemoglobin subunit alpha (Gene Name=hba)