Structure of PDB 4esv Chain C

Receptor sequence

>4esvC (length=434) Species: 1422 (Geobacillus stearothermophilus)

RIPPQSIEAEQAVLGAVFLDPAALVPASEILIPEDFYRAAHQKIFHAMLR
VADRGEPVDLVTVTAELAASEQLEEIGGVSYLSELADAVPTAANVEYYAR
IVEEKSVLRRLIRTATSIAQDGYTREDEIDVLLDEADRKIMEVSQRKHSG
AFKNIKDILVQTYDNIEMLHNRDGEITGIPTGFTELDRMTSGFQRSDLII
VAARPSVGKTAFALNIAQNVATKTNENVAIFSLEMSAQQLVMRMLCAEGN
INAQNLRTGKLTPEDWGKLTMAMGSLSNAGIYIDDTPSIRVSDIRAKCRR
LKQESGLGMIVIDYLQLIQGSGRSKENRQQEVSEISRSLKALARELEVPV
IALSQLSRSVEQRQDKRPMMSDIRESGSIEQDADIVAFLYRDDYYNKDSE
NKNIIEIIIAKQRNGPVGTVQLAFIKEYNKFVNL

3D structure

• PDB: 4esv The Hexameric Helicase DnaB Adopts a Nonplanar Conformation during Translocation.
• Chain: C
• Resolution: 3.2 Å

Enzymatic activity

• Enzyme Commision number: 3.6.4.12: DNA helicase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	dna	C	Q336 R365 R381 E382 G384	Q329 R358 R374 E375 G377
BS02	GDP	C	S213 G215 K216 T217 A218 R250 K433 E434	S206 G208 K209 T210 A211 R243 K426 E427
BS03	CA	C	T217 D320	T210 D313
BS04	ALF	C	P212 K216 E241 Q362	P205 K209 E234 Q355
BS05	ALF	C	K418 R420	K411 R413
BS06	GDP	C	Q419 N421 G422 P423	Q412 N414 G415 P416

Gene Ontology

Molecular Function

• GO:0003677 DNA binding
• GO:0003678 DNA helicase activity
• GO:0004386 helicase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016787 hydrolase activity
• GO:0016853 isomerase activity
• GO:0016887 ATP hydrolysis activity
• GO:0042802 identical protein binding

Biological Process

• GO:0006260 DNA replication
• GO:0006268 DNA unwinding involved in DNA replication
• GO:0006269 DNA replication, synthesis of primer

Cellular Component

• GO:0005829 cytosol
• GO:1990077 primosome complex

External links

• PDB: RCSB:4esv, PDBe:4esv, PDBj:4esv
• PDBsum: 4esv
• PubMed: 23022319
• UniProt: Q9X4C9|DNAB_GEOSE Replicative DNA helicase DnaB (Gene Name=dnaB)