Structure of PDB 4ekc Chain C

Receptor sequence
>4ekcC (length=317) Species: 10090 (Mus musculus) [Search protein sequence]
RRELKLLLLGTGESGKSTFIKQMRIIHGSGYSDEDKRGFTKLVYQNIFTA
MQAMIRAMDTLKIPYKYEHNKAHAQLVREVDVEKVSAFDVPDYAAIKSLW
NDPGIQECYDRRREYQLSDSTKYYLNDLDRVADPSYLPTQQDVLRVCVPT
TGIIEYPFDLQSVIFRMVDVGGQRSERRKWIHCFENVTSIMFLVALSEYD
QVLVESDNENRMEESKALFRTIITYPWFQNSSVILFLNKKDLLEEKIMYS
HLVDYFPEYDGPQRDAQAAREFILKMFVDLNPDSDKIIYSHFTCATDTEN
IRFVFAAVKDTILQLNL
3D structure
PDB4ekc Structural and functional analysis of the regulator of G protein signaling 2-g alpha q complex.
ChainC
Resolution7.4 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) E49 T54 C183 D205 Q209
Catalytic site (residue number reindexed from 1) E13 T18 C147 D169 Q173
Enzyme Commision number 3.6.5.1: heterotrimeric G-protein GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 GDP C E49 G51 K52 S53 T54 L180 R181 V182 C183 N274 K275 D277 L278 C330 A331 E13 G15 K16 S17 T18 L144 R145 V146 C147 N238 K239 D241 L242 C294 A295
BS02 ALF C G48 E49 K52 T186 G208 Q209 G12 E13 K16 T150 G172 Q173
BS03 MG C S53 T186 S17 T150
Gene Ontology
Molecular Function
GO:0001664 G protein-coupled receptor binding
GO:0003924 GTPase activity
GO:0003925 G protein activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
GO:0019001 guanyl nucleotide binding
GO:0030234 enzyme regulator activity
GO:0031683 G-protein beta/gamma-subunit complex binding
GO:0046872 metal ion binding
GO:0047391 alkylglycerophosphoethanolamine phosphodiesterase activity
Biological Process
GO:0001501 skeletal system development
GO:0001508 action potential
GO:0007165 signal transduction
GO:0007186 G protein-coupled receptor signaling pathway
GO:0007189 adenylate cyclase-activating G protein-coupled receptor signaling pathway
GO:0007200 phospholipase C-activating G protein-coupled receptor signaling pathway
GO:0007207 phospholipase C-activating G protein-coupled acetylcholine receptor signaling pathway
GO:0007215 glutamate receptor signaling pathway
GO:0007507 heart development
GO:0008217 regulation of blood pressure
GO:0009791 post-embryonic development
GO:0010543 regulation of platelet activation
GO:0016322 neuron remodeling
GO:0021884 forebrain neuron development
GO:0032024 positive regulation of insulin secretion
GO:0042711 maternal behavior
GO:0042733 embryonic digit morphogenesis
GO:0045634 regulation of melanocyte differentiation
GO:0048066 developmental pigmentation
GO:0060158 phospholipase C-activating dopamine receptor signaling pathway
GO:0086100 endothelin receptor signaling pathway
GO:0099105 ion channel modulating, G protein-coupled receptor signaling pathway
GO:1904888 cranial skeletal system development
GO:1990806 ligand-gated ion channel signaling pathway
Cellular Component
GO:0005634 nucleus
GO:0005794 Golgi apparatus
GO:0005834 heterotrimeric G-protein complex
GO:0005886 plasma membrane
GO:0016020 membrane
GO:0030425 dendrite
GO:0031965 nuclear membrane
GO:0044297 cell body
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4ekc, PDBe:4ekc, PDBj:4ekc
PDBsum4ekc
PubMed23434405
UniProtP21279|GNAQ_MOUSE Guanine nucleotide-binding protein G(q) subunit alpha (Gene Name=Gnaq)

[Back to BioLiP]