Structure of PDB 4eg2 Chain C

Receptor sequence

>4eg2C (length=296) Species: 666 (Vibrio cholerae)

AMRNRIEQALQQMPASFAPYLRELVLAKDFDATFSAEQYQQLLTLSGLED
ADLRVALLPIAAAYSYAPISEFYVGAIVRGISGRLYLGANMEFTGAQLGQ
TVHAEQCAISHAWMKGEKGVADITINFSPCGHCRQFMNELTTASSLKIQL
PKRAAKTLQEYLPESFGPADLGIDSGLMSPVNHGKTSDDDEELIQQALRA
MNISHSPYTQNFSGVALKMRSGAIYLGAYAENAAFNPSLPPLQVALAQAM
MMGESFEDIEAAALVESATGKISHLADTQATLEVINPDIPLSYLSL

3D structure

• PDB: 4eg2 2.2 Angstrom Crystal Structure of Cytidine deaminase from Vibrio cholerae in Complex with Zinc and Uridine.
• Chain: C
• Resolution: 2.2 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): H102 E104 C129 C132
• Catalytic site (residue number reindexed from 1): H103 E105 C130 C133
• Enzyme Commision number: 3.5.4.5: cytidine deaminase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	H102 C129 C132	H103 C130 C133
BS02	URI	C	N89 E91 H102 E104	N90 E92 H103 E105
BS03	URI	C	F165 A232 A233 F234	F166 A233 A234 F235

Gene Ontology

Molecular Function

• GO:0003824 catalytic activity
• GO:0004126 cytidine deaminase activity
• GO:0008270 zinc ion binding
• GO:0016787 hydrolase activity
• GO:0042802 identical protein binding
• GO:0046872 metal ion binding

Biological Process

• GO:0009972 cytidine deamination
• GO:0055086 nucleobase-containing small molecule metabolic process
• GO:0072527 pyrimidine-containing compound metabolic process
• GO:1901135 carbohydrate derivative metabolic process

Cellular Component

• GO:0005737 cytoplasm
• GO:0005829 cytosol

External links

• PDB: RCSB:4eg2, PDBe:4eg2, PDBj:4eg2
• PDBsum: 4eg2
• UniProt: Q9KSM5|CDD_VIBCH Cytidine deaminase (Gene Name=cdd)