Structure of PDB 4eaj Chain C

Receptor sequence

>4eajC (length=289) Species: 10116 (Rattus norvegicus)

SVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWD
SKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYKPLVC
ISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVV
DEKGRVVDIYSKFDVINLAANLDVSVTKALQHRSHYFEGVLKCYLHETLE
AIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLT

3D structure

• PDB: 4eaj AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
• Chain: C
• Resolution: 2.609 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ATP	C	R69 K169 I239 F243 D244 V275 L276 V296 H297 R298	R44 K139 I209 F213 D214 V240 L241 V261 H262 R263
BS02	ATP	C	R69 M84 T86 T88 D89 L128 V129 I149 H150 R151	R44 M59 T61 T63 D64 L98 V99 I119 H120 R121
BS03	AMP	C	H150 T199 I203 A204 V224 S225 H297 I311 S313 D316	H120 T169 I173 A174 V194 S195 H262 I276 S278 D281

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004679 AMP-activated protein kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016208 AMP binding
• GO:0019887 protein kinase regulator activity
• GO:0019901 protein kinase binding
• GO:0043531 ADP binding
• GO:0044877 protein-containing complex binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0010628 positive regulation of gene expression
• GO:0031669 cellular response to nutrient levels
• GO:0051170 import into nucleus

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031588 nucleotide-activated protein kinase complex
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:4eaj, PDBe:4eaj, PDBj:4eaj
• PDBsum: 4eaj
• PubMed: 22659875
• UniProt: P80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=Prkag1)