Structure of PDB 4eai Chain C

Receptor sequence

>4eaiC (length=289) Species: 10116 (Rattus norvegicus)

SVYTTFMKSHRCYDLIPTSSKLVVFDTSLQVKKAFFALVTNGVRAAPLWD
SKKQSFVGMLTITDFINILHRYYKSALVQIYELEEHKIETWREVYKPLVC
ISPNASLFDAVSSLIRNKIHRLPVIDPESGNTLYILTHKRILKFLKLFIT
EFPKPEFMSKSLEELQIGTYANIAMVRTTTPVYVALGIFVQHRVSALPVV
DEKGRVVDIYSKFDVINLAANLDVSVTKALQHRSHYFEGVLKCYLHETLE
AIINRLVEAEVHRLVVVDEHDVVKGIVSLSDILQALVLT

3D structure

• PDB: 4eai AMP-activated protein kinase undergoes nucleotide-dependent conformational changes
• Chain: C
• Resolution: 2.285 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	AMP	C	R69 I239 S241 F243 D244 F272 V275 L276 V296 H297 R298	R44 I209 S211 F213 D214 F237 V240 L241 V261 H262 R263
BS02	AMP	C	M84 T86 T88 D89 L128 V129 I149 H150 R151	M59 T61 T63 D64 L98 V99 I119 H120 R121
BS03	AMP	C	H150 T199 I203 A204 V224 S225 H297 S313 S315 D316	H120 T169 I173 A174 V194 S195 H262 S278 S280 D281

Gene Ontology

Molecular Function

• GO:0004672 protein kinase activity
• GO:0004679 AMP-activated protein kinase activity
• GO:0005515 protein binding
• GO:0005524 ATP binding
• GO:0016208 AMP binding
• GO:0019887 protein kinase regulator activity
• GO:0019901 protein kinase binding
• GO:0043531 ADP binding
• GO:0044877 protein-containing complex binding

Biological Process

• GO:0006633 fatty acid biosynthetic process
• GO:0010628 positive regulation of gene expression
• GO:0031669 cellular response to nutrient levels
• GO:0051170 import into nucleus

Cellular Component

• GO:0005634 nucleus
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0031588 nucleotide-activated protein kinase complex
• GO:0032991 protein-containing complex

External links

• PDB: RCSB:4eai, PDBe:4eai, PDBj:4eai
• PDBsum: 4eai
• PubMed: 22659875
• UniProt: P80385|AAKG1_RAT 5'-AMP-activated protein kinase subunit gamma-1 (Gene Name=Prkag1)