Structure of PDB 4d4o Chain C

Receptor sequence
>4d4oC (length=75) Species: 559292 (Saccharomyces cerevisiae S288C) [Search protein sequence]
SMSTYDEIEIEDMTFEPENQMFTYPCPCGDRFQIYLDDMFEGEKVAVCPS
CSLMIDVVFDKEDLAEYYEEAGIHP
3D structure
PDB4d4o Structure of the Kti11/Kti13 Heterodimer and its Double Role in Modifications of tRNA and Eukaryotic Elongation Factor 2.
ChainC
Resolution2.897 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 FE C C368 C370 C390 C393 C26 C28 C48 C51
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0005506 iron ion binding
GO:0005515 protein binding
GO:0008198 ferrous iron binding
GO:0008270 zinc ion binding
GO:0016491 oxidoreductase activity
GO:0016730 oxidoreductase activity, acting on iron-sulfur proteins as donors
GO:0034986 iron chaperone activity
GO:0046872 metal ion binding
GO:0061630 ubiquitin protein ligase activity
GO:0090560 2-(3-amino-3-carboxypropyl)histidine synthase activity
Biological Process
GO:0002098 tRNA wobble uridine modification
GO:0002926 tRNA wobble base 5-methoxycarbonylmethyl-2-thiouridinylation
GO:0006511 ubiquitin-dependent protein catabolic process
GO:0008033 tRNA processing
GO:0016567 protein ubiquitination
GO:0017183 protein histidyl modification to diphthamide
Cellular Component
GO:0005634 nucleus
GO:0005737 cytoplasm
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4d4o, PDBe:4d4o, PDBj:4d4o
PDBsum4d4o
PubMed25543256
UniProtP31386|ATS1_YEAST Protein KTI13 (Gene Name=ATS1);
Q3E840|DPH3_YEAST Diphthamide biosynthesis protein 3 (Gene Name=KTI11)

[Back to BioLiP]