Structure of PDB 4d41 Chain C
Receptor sequence
| >4d41C (length=254) Species: 1280 (Staphylococcus aureus) [Search protein sequence] |
| NLENKTYVIMGIANKRSIAFGVAKVLDQLGAKLVFTYRKERSRKELEKLL EQLNQPEAHLYQIDVQSDEEVINGFEQIGKDVGNIDGVYHSIAFANMEDL RGRFSETSREGFLLAQDISSYSLTIVAHEAKKLMPEGGSIVATTYLGGEF AVQNYNVMGVAKASLEANVKYLALDLGPDNIRVNAISAGPIRTLSAKGVG GFNTILKEIEERAPLKRNVDQVEVGKTAAYLLSDLSSGVTGENIHVDSGF HAIK |
3D structure
| PDB | 4d41 An Ordered Water Channel in Staphylococcus Aureus Fabi: Unraveling the Mechanism of Substrate Recognition and Reduction. | ||
| Chain | C | ||
| Resolution | 2.3 Å | ||
| 3D structure |
|
Enzymatic activity
| Catalytic site (original residue number in PDB) | Y147 Y157 M160 K164 K199 |
| Catalytic site (residue number reindexed from 1) | Y145 Y155 M158 K162 K197 |
| Enzyme Commision number | 1.3.1.39: enoyl-[acyl-carrier-protein] reductase (NADPH, Re-specific). |
Interaction with ligand
| Site # |
Ligand | Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
|---|---|---|---|---|---|
| BS01 | JA1 | C | A95 F96 A97 Y147 Y157 M160 S197 F204 I207 | A93 F94 A95 Y145 Y155 M158 S195 F202 I205 | MOAD: Ki=0.05nM |
| BS02 | NAP | C | G13 A15 S19 I20 R40 K41 S44 D66 V67 S93 I94 A95 I120 T145 T146 Y147 K164 G191 P192 I193 T195 S197 | G11 A13 S17 I18 R38 K39 S42 D64 V65 S91 I92 A93 I118 T143 T144 Y145 K162 G189 P190 I191 T193 S195 |
Gene Ontology
| Molecular Function | |
|---|---|
| GO:0000166 | nucleotide binding |
| GO:0004318 | enoyl-[acyl-carrier-protein] reductase (NADH) activity |
| GO:0016491 | oxidoreductase activity |
| GO:0141148 | enoyl-[acyl-carrier-protein] reductase (NADPH) activity |
