Structure of PDB 4cz5 Chain C

Receptor sequence
>4cz5C (length=32) Species: 7955 (Danio rerio) [Search protein sequence]
GSEEIFTLQVRGRERYEILKKLNDSLELSDVV
3D structure
PDB4cz5 Tracing the Evolution of the P53 Tetramerization Domain
ChainC
Resolution1.02 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 peptide C S324 L325 S328 V330 S25 L26 S29 V31
BS02 peptide C E302 E303 I304 F305 T306 L307 Q308 V309 R310 G311 R312 E313 R314 Y315 L318 N322 L325 E326 V331 E3 E4 I5 F6 T7 L8 Q9 V10 R11 G12 R13 E14 R15 Y16 L19 N23 L26 E27 V32
Gene Ontology
Biological Process
GO:0051262 protein tetramerization

View graph for
Biological Process
External links
PDB RCSB:4cz5, PDBe:4cz5, PDBj:4cz5
PDBsum4cz5
PubMed25185827
UniProtP79734|P53_DANRE Cellular tumor antigen p53 (Gene Name=tp53)

[Back to BioLiP]