Structure of PDB 4cqm Chain C

Receptor sequence
>4cqmC (length=232) Species: 9606 (Homo sapiens) [Search protein sequence]
KVCAVFGGSRGIGRAVAQLMARKGYRLAVIARNLEGAKAAAGDLGGDHLA
FSCDVAKEHDVQNTFEELEKHLGRVNFLVNAAGINRDGLLVRTKTEDMVS
QLHTNLLGSMLTCKAAMRTMIQQQGGSIVNVGSIVGLKGNSGQSVYSASK
GGLVGFSRALAKEVARKKIRVNVVAPGFVHTKDLKEEHLKKNIPLGRFGE
TIEVAHAVVFLLESPYITGHVLVVDGGLQLIL
3D structure
PDB4cqm Insights Into Mitochondrial Fatty Acid Synthesis from the Structure of Heterotetrameric 3-Ketoacyl-Acp Reductase/3R-Hydroxyacyl-Coa Dehydrogenase.
ChainC
Resolution2.339 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) G13 S135 Q145 Y148 K152
Catalytic site (residue number reindexed from 1) G11 S133 Q143 Y146 K150
Enzyme Commision number 1.1.1.100: 3-oxoacyl-[acyl-carrier-protein] reductase.
1.6.5.10: NADPH dehydrogenase (quinone).
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 NAP C G9 S11 R12 G13 I14 A33 R34 N35 D56 V57 A84 G85 I86 T106 G7 S9 R10 G11 I12 A31 R32 N33 D54 V55 A82 G83 I84 T104 MOAD: Kd=26.8uM
Gene Ontology
Molecular Function
GO:0003955 NAD(P)H dehydrogenase (quinone) activity
GO:0004316 3-oxoacyl-[acyl-carrier-protein] reductase (NADPH) activity
GO:0005515 protein binding
GO:0008753 NADPH dehydrogenase (quinone) activity
GO:0016491 oxidoreductase activity
GO:0016616 oxidoreductase activity, acting on the CH-OH group of donors, NAD or NADP as acceptor
GO:0048038 quinone binding
GO:0070402 NADPH binding
Biological Process
GO:0006633 fatty acid biosynthetic process
GO:0044597 daunorubicin metabolic process
GO:0044598 doxorubicin metabolic process
GO:0046949 fatty-acyl-CoA biosynthetic process
GO:0051289 protein homotetramerization
GO:0051290 protein heterotetramerization
Cellular Component
GO:0005739 mitochondrion
GO:0005759 mitochondrial matrix
GO:1990204 oxidoreductase complex

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4cqm, PDBe:4cqm, PDBj:4cqm
PDBsum4cqm
PubMed25203508
UniProtQ8N4T8|CBR4_HUMAN 3-oxoacyl-[acyl-carrier-protein] reductase (Gene Name=CBR4)

[Back to BioLiP]