Structure of PDB 4c3k Chain C

Receptor sequence
>4c3kC (length=98) Species: 32046 (Synechococcus elongatus) [Search protein sequence]
MKKIEAIIRPFKLDEVKIALVNAGIVGMTVSEVRGFGRQEYTVEFLQKLK
LEIVVEDAQVDTVIDKIVAAARTGEIGDGKIFVSPVDQTIRIRTGEKN
3D structure
PDB4c3k Structural Basis and Target-Specific Modulation of Adp Sensing by the Synechococcus Elongatus Pii Signaling Protein.
ChainC
Resolution3.099 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 ADP C G35 F36 G37 R38 K58 G87 D88 K90 F92 G35 F36 G37 R38 K48 G77 D78 K80 F82
Gene Ontology
Molecular Function
GO:0000166 nucleotide binding
GO:0005515 protein binding
GO:0005524 ATP binding
GO:0030234 enzyme regulator activity
GO:0042802 identical protein binding
Biological Process
GO:0006808 regulation of nitrogen utilization
Cellular Component
GO:0005829 cytosol

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4c3k, PDBe:4c3k, PDBj:4c3k
PDBsum4c3k
PubMed24519945
UniProtP0A3F4|GLNB_SYNE7 Nitrogen regulatory protein P-II (Gene Name=glnB)

[Back to BioLiP]