Structure of PDB 4c0a Chain C

Receptor sequence
>4c0aC (length=161) Species: 9913 (Bos taurus) [Search protein sequence]
MRILMVGLDAAGKTTILYKLKLGEIVTTIPTIGFNVETVEYKNISFTVWD
VGGQDKIRPLWRHYFQNTQGLIFVVDSNDRERVNEAREELMRMLAEDELR
DAVLLVFANKQDLPNAMNAAEITDKLGLHSLRHRNWYIQATCATSGDGLY
EGLDWLSNQLR
3D structure
PDB4c0a Integrated conformational and lipid-sensing regulation of endosomal ArfGEF BRAG2.
ChainC
Resolution3.3 Å
3D
structure
Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Catalytic site (original residue number in PDB) Q71
Catalytic site (residue number reindexed from 1) Q54
Enzyme Commision number 3.6.5.2: small monomeric GTPase.
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 G3D C A27 G29 K30 T31 T32 N126 K127 D129 C159 A160 T161 A10 G12 K13 T14 T15 N109 K110 D112 C142 A143 T144
Gene Ontology
Molecular Function
GO:0003924 GTPase activity
GO:0005515 protein binding
GO:0005525 GTP binding
GO:0016787 hydrolase activity
Biological Process
GO:0002090 regulation of receptor internalization
GO:0006886 intracellular protein transport
GO:0015031 protein transport
GO:0016192 vesicle-mediated transport
GO:0034315 regulation of Arp2/3 complex-mediated actin nucleation
GO:0060292 long-term synaptic depression
GO:0097061 dendritic spine organization
Cellular Component
GO:0000139 Golgi membrane
GO:0005794 Golgi apparatus
GO:0005829 cytosol
GO:0005886 plasma membrane
GO:0014069 postsynaptic density
GO:0016020 membrane
GO:0042583 chromaffin granule
GO:0043005 neuron projection
GO:0045202 synapse

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4c0a, PDBe:4c0a, PDBj:4c0a
PDBsum4c0a
PubMed24058294
UniProtP84080|ARF1_BOVIN ADP-ribosylation factor 1 (Gene Name=ARF1)

[Back to BioLiP]