Structure of PDB 4by5 Chain C

Receptor sequence
>4by5C (length=169) Species: 7227 (Drosophila melanogaster) [Search protein sequence]
KLKQDTIDRLTTDTYFTEKEIRQWHKGFLKDCPNGLLTEQGFIKIYKQFF
PDGDPSKFASLVFRVFDENNDGAIEFEEFIRALSITSRGNLDEKLHWAFR
LYDVDNDGYITREEMYNIVDAIYQMVGTPQKRVDKIFDQMDKNHDDRLTL
EEFREGSKADPRMVQALSL
3D structure
PDB4by5 The Guanine-Exchange Factor Ric8A Binds the Calcium Sensor Ncs-1 to Regulate Synapse Number and Probability of Release.
ChainC
Resolution2.22 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 CA C D73 N75 D77 A79 E84 D67 N69 D71 A73 E78
BS02 CA C D109 D111 D113 Y115 E120 D103 D105 D107 Y109 E114
BS03 CA C D156 N158 D160 R162 E167 D141 N143 D145 R147 E152
Gene Ontology
Molecular Function
GO:0005509 calcium ion binding
GO:0005515 protein binding
GO:0008048 calcium sensitive guanylate cyclase activator activity
GO:0046872 metal ion binding
Biological Process
GO:0007268 chemical synaptic transmission
GO:0007269 neurotransmitter secretion
GO:0007528 neuromuscular junction development
GO:0016192 vesicle-mediated transport
GO:0046928 regulation of neurotransmitter secretion
Cellular Component
GO:0005737 cytoplasm
GO:0008021 synaptic vesicle

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:4by5, PDBe:4by5, PDBj:4by5
PDBsum4by5
PubMed25074811
UniProtQ9VWX8|FRQ2_DROME Frequenin-2 (Gene Name=Frq2)

[Back to BioLiP]