Structure of PDB 4bww Chain C |
>4bwwC (length=128) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence] |
AECSVDIQGNDQMQFNTNAICVDKSCKQFTVNLSHPGNLPKNVMGHNWVL STAADMQGVVTDGMASGLDKDYLKPDDSRVIAHTKLIGSGEKDSVTFDVS KLKEGEQYMFFCTFPGHSALMKGTLTLK |
|
PDB | 4bww High-Resolution Crystal Structure of Spin Labelled (T21R1) Azurin from Pseudomonas Aeruginosa: A Challenging Structural Benchmark for in Silico Spin Labelling Algorithms. |
Chain | C |
Resolution | 1.48 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
CU |
C |
G45 H46 C112 H117 |
G45 H46 C112 H117 |
|
|
|
|