Structure of PDB 4bpd Chain C |
>4bpdC (length=93) Species: 83333 (Escherichia coli K-12) [Search protein sequence] |
AAFRQEGVAVLLCVVIAAWLDVDAVTRVLLISSVMLVMIVELLNSAIEAV VDRIGSEYHELSGRAKDLGSAAVLIAIIDAVITWAILLWSHFG |
|
PDB | 4bpd Cell-Free Expression and in Meso Crystallisation of an Integral Membrane Kinase for Structure Determination. |
Chain | C |
Resolution | 3.3 Å |
3D structure |
|
|
Enzyme Commision number |
2.7.1.107: diacylglycerol kinase (ATP). |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
78M |
C |
A113 I114 W117 |
A85 I86 W89 |
|
|
|
|