Structure of PDB 4bl5 Chain C

Receptor sequence

>4bl5C (length=321) Species: 9606 (Homo sapiens) [Search protein sequence]

ENLYFQSMRILVTGGSGLVGKAIQKVVADGAGLPGEDWVFVSSKDADLTD
TAQTRALFEKVQPTHVIHLAAMVGGLFRNIKYNLDFWRKNVHMNDNVLHS
AFEVGARKVVSCLSTCIFPDKTTYPIDETMIHNGPPHNSNFGYSYAKRMI
DVQNRAYFQQYGCTFTAVIPTNVFGPHDNFNIEDGHVLPGLIHKVHLAKS
SGSALTVWGTGNPRRQFIYSLDLAQLFIWVLREYNEVEPIILSVGEEDEV
SIKEAAEAVVEAMDFHGEVTFDTTKSDGQFKKTASNSKLRTYLPDFRFTP
FKQAVKETCAWFTDNYEQARK

3D structure

PDB

4bl5 Crystal Structure of Human Gdp-L-Fucose Synthase with Bound Nadp and Product Gdp-L-Fucose

Chain

Resolution

2.6 Å

3D
structure

Catalytic site residues are labeled in the structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Catalytic site (original residue number in PDB)	S114 T115 C116 Y143 K147 H186
Catalytic site (residue number reindexed from 1)	S114 T115 C116 Y143 K147 H186
Enzyme Commision number	1.1.1.271: GDP-L-fucose synthase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	NAP	C	G14 S16 G17 L18 S43 A46 D47 L48 L69 A71 V73 M93 C112 S114 Y143 K147 T171 V173 R320	G14 S16 G17 L18 S43 A46 D47 L48 L69 A71 V73 M93 C112 S114 Y143 K147 T171 V173 R320
BS02	GFB	C	G74 G75 L76 F77 S114 C116 Y143 H186 V187 K194 W208 R215 D277 K282	G74 G75 L76 F77 S114 C116 Y143 H186 V187 K194 W208 R215 D277 K282

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0009055	electron transfer activity
GO:0016491	oxidoreductase activity
GO:0016853	isomerase activity
GO:0042356	GDP-4-dehydro-D-rhamnose reductase activity
GO:0042802	identical protein binding
GO:0047918	GDP-mannose 3,5-epimerase activity
GO:0050577	GDP-L-fucose synthase activity

	Biological Process
GO:0007159	leukocyte cell-cell adhesion
GO:0009226	nucleotide-sugar biosynthetic process
GO:0010595	positive regulation of endothelial cell migration
GO:0019673	GDP-mannose metabolic process
GO:0042351	'de novo' GDP-L-fucose biosynthetic process
GO:1904906	positive regulation of endothelial cell-matrix adhesion via fibronectin

	Cellular Component
GO:0005829	cytosol
GO:0070062	extracellular exosome

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:4bl5, PDBe:4bl5, PDBj:4bl5
PDBsum	4bl5
PubMed
UniProt	Q13630\|FCL_HUMAN GDP-L-fucose synthase (Gene Name=GFUS)

[Back to BioLiP]