Structure of PDB 4a9i Chain C |
>4a9iC (length=107) Species: 9606 (Homo sapiens) [Search protein sequence] |
TNQLQYLHKVVMKALWKHQFAWPFRQPVDAVKLGLPDYHKIIKQPMDMGT IKRRLENNYYWAASECMQDFNTMFTNCYIYNKPTDDIVLMAQTLEKIFLQ KVASMPQ |
|
PDB | 4a9i Fragment-Based Discovery of Bromodomain Inhibitors Part 1: Inhibitor Binding Modes and Implications for Lead Discovery. |
Chain | C |
Resolution | 2.25 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
P9I |
C |
W97 N156 I162 |
W22 N81 I87 |
|
|
|