Structure of PDB 4a69 Chain C |
>4a69C (length=69) Species: 9606 (Homo sapiens) [Search protein sequence] |
KFINMNGLMADPMKVYKDRQVMNMWSEQEKETFREKFMQHPKNFGLIASF LERKTVAECVLYYYLTKKN |
|
PDB | 4a69 Structure of Hdac3 Bound to Co-Repressor and Inositol Tetraphosphate. |
Chain | C |
Resolution | 2.06 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
I0P |
C |
K449 Y470 Y471 K474 |
K42 Y63 Y64 K67 |
|
|
|