Structure of PDB 4a25 Chain C |
>4a25C (length=169) Species: 131568 (Kineococcus radiotolerans) [Search protein sequence] |
TTIHDVQTTGLTQDAVTGFDASSRLNAGLQEVLVDLTALHLQGKQAHWNI VGENWRDLHLQLDTLVEAARGFSDDVAERMRAVGGVPDARPQTVAASRIG DVGPDEIDTRACVEAIVALVRHTVDTIRRVHDPIDAEDPASADLLHAITL ELEKQAWMIGSENRSPRRR |
|
PDB | 4a25 Kineococcus Radiotolerans Dps Forms a Heteronuclear Mn-Fe Ferroxidase Center that May Explain the Mn-Dependent Protection Against Oxidative Stress. |
Chain | C |
Resolution | 2.0 Å |
3D structure |
|
|
Enzyme Commision number |
? |
|
Site # |
Ligand |
Ligand chain |
Binding residues on receptor (original residue number in PDB) |
Binding residues on receptor (residue number reindexed from 1) |
Binding affinity |
BS01 |
MN |
C |
N55 D58 |
N54 D57 |
|
BS02 |
MN |
C |
D75 E79 |
D74 E78 |
|
|
|
|