Structure of PDB 3wth Chain C

Receptor sequence

>3wthC (length=208) Species: 6523 (Lymnaea stagnalis)

AADRADILYNIRQTSRPDVIPTQRDRPVAVSVSLKFINILEVNEITNEVD
VVFWQRTTWSDRTLAWDSSHSPDQVSVPISSLWVPDLAAYNAISKPEVLT
PQLARVVSDGEVLYMPSIRQRFSCDVSGVDTESGATCRIKIGSWTHHSRE
ISVDPTTENSDDSEYFSQYSRFEILDVTQKKNSVTYSCCPEAYEDVEVSL
NFRKKGRS

3D structure

• PDB: 3wth Studies on an acetylcholine binding protein identify a basic residue in loop G on the beta 1 strand as a new structural determinant of neonicotinoid actions
• Chain: C
• Resolution: 2.54 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	IM4	C	W53 R104 L112 Y113 M114	W54 R105 L113 Y114 M115	BindingDB: Ki=970nM
BS02	IM4	C	W143 Y185	W144 Y186	BindingDB: Ki=970nM

Gene Ontology

Molecular Function

• GO:0004888 transmembrane signaling receptor activity
• GO:0005216 monoatomic ion channel activity
• GO:0005230 extracellular ligand-gated monoatomic ion channel activity
• GO:0005231 excitatory extracellular ligand-gated monoatomic ion channel activity
• GO:1904315 transmitter-gated monoatomic ion channel activity involved in regulation of postsynaptic membrane potential

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007165 signal transduction
• GO:0007268 chemical synaptic transmission
• GO:0034220 monoatomic ion transmembrane transport
• GO:0042391 regulation of membrane potential
• GO:0050877 nervous system process
• GO:0060078 regulation of postsynaptic membrane potential
• GO:0060079 excitatory postsynaptic potential

Cellular Component

• GO:0005576 extracellular region
• GO:0016020 membrane
• GO:0043005 neuron projection
• GO:0043083 synaptic cleft
• GO:0045202 synapse
• GO:0098794 postsynapse

External links

• PDB: RCSB:3wth, PDBe:3wth, PDBj:3wth
• PDBsum: 3wth
• PubMed: 25267717
• UniProt: P58154|ACHP_LYMST Acetylcholine-binding protein