Structure of PDB 3wfe Chain C

Receptor sequence
>3wfeC (length=142) Species: 208964 (Pseudomonas aeruginosa PAO1) [Search protein sequence]
FTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAMSAAVVRGKL
VWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPL
NVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG
3D structure
PDB3wfe Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes.
ChainC
Resolution2.49 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 HEM C A72 Y73 A68 Y69
BS02 10M C N138 Q139 N134 Q135
BS03 CA C G71 Y73 G67 Y69
BS04 HEC C C61 C64 H65 A75 L78 V81 R84 R85 W98 R109 R110 M112 P113 F115 C57 C60 H61 A71 L74 V77 R80 R81 W94 R105 R106 M108 P109 F111
Gene Ontology
Molecular Function
GO:0009055 electron transfer activity
GO:0020037 heme binding
GO:0046872 metal ion binding
Cellular Component
GO:0005886 plasma membrane

View graph for
Molecular Function
View graph for
Cellular Component
External links
PDB RCSB:3wfe, PDBe:3wfe, PDBj:3wfe
PDBsum3wfe
PubMed24338896
UniProtQ59646|NORC_PSEAE Nitric oxide reductase subunit C (Gene Name=norC)

[Back to BioLiP]