Structure of PDB 3wfd Chain C

Receptor sequence

>3wfdC (length=142) Species: 208964 (Pseudomonas aeruginosa PAO1)

FTKGMARNIYFGGSVFFILLFLALTYHTEKTLPERTNEAAMSAAVVRGKL
VWEQNNCVGCHTLLGEGAYFAPELGNVVGRRGGEEGFNTFLQAWMKIQPL
NVPGRRAMPQFHLSEGQVDDLAEFLKWSSKIDTNQWPPNKEG

3D structure

• PDB: 3wfd Structures of reduced and ligand-bound nitric oxide reductase provide insights into functional differences in respiratory enzymes.
• Chain: C
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	HEM	C	A72 Y73	A68 Y69
BS02	CA	C	G71 Y73	G67 Y69
BS03	HEC	C	C61 C64 H65 A75 L78 V81 R84 R85 W98 R109 R110 M112 P113 F115	C57 C60 H61 A71 L74 V77 R80 R81 W94 R105 R106 M108 P109 F111

Gene Ontology

Molecular Function

• GO:0009055 electron transfer activity
• GO:0020037 heme binding
• GO:0046872 metal ion binding

Cellular Component

• GO:0005886 plasma membrane

External links

• PDB: RCSB:3wfd, PDBe:3wfd, PDBj:3wfd
• PDBsum: 3wfd
• PubMed: 24338896
• UniProt: Q59646|NORC_PSEAE Nitric oxide reductase subunit C (Gene Name=norC)