Structure of PDB 3wbm Chain C

Receptor sequence
>3wbmC (length=86) Species: 2286 (Saccharolobus shibatae) [Search protein sequence]
TPTPSNVVLIGKKPVMNYVLAALTLLNQGVSEIVIKARGRAISKAVDTVE
IVRNRFLPDKIEIKEIRVGSQVVSRVSTIEIAIRKK
3D structure
PDB3wbm Biochemical and structural insights into RNA binding by Ssh10b, a member of the highly conserved Sac10b protein family in Archaea.
ChainC
Resolution2.0 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number 3.1.-.-
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 rna C G15 K16 G43 R44 G11 K12 G39 R40
Gene Ontology
Molecular Function
GO:0003676 nucleic acid binding
GO:0003677 DNA binding
GO:0003690 double-stranded DNA binding
GO:0003723 RNA binding
GO:0004518 nuclease activity
Biological Process
GO:0030261 chromosome condensation
Cellular Component
GO:0005694 chromosome
GO:0005737 cytoplasm

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3wbm, PDBe:3wbm, PDBj:3wbm
PDBsum3wbm
PubMed24307170
UniProtP60848|ALBA1_SACSH DNA/RNA-binding protein Alba 1 (Gene Name=albA1)

[Back to BioLiP]