Structure of PDB 3wbg Chain C

Receptor sequence

>3wbgC (length=132) Species: 9606 (Homo sapiens) [Search protein sequence]

MVDAFLGTWKLVDSKNFDDYMKSLGVGFATRQVASMTKPTTIIEKNGDIL
TLKTHSTFKNTEISFKLGVEFDETTADDRKVKSIVTLDGGKLVHLQKWDG
QETTLVRELIDGKLILTLTHGTAVCTRTYEKE

3D structure

PDB

3wbg Structure of the human-heart fatty-acid-binding protein 3 in complex with the fluorescent probe 1-anilinonaphthalene-8-sulphonic acid

Chain

Resolution

2.15 Å

3D
structure

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	2AN	C	F16 S55 A75	F17 S56 A76

Gene Ontology

	Molecular Function
GO:0005515	protein binding
GO:0008092	cytoskeletal protein binding
GO:0008289	lipid binding
GO:0036041	long-chain fatty acid binding
GO:0070538	oleic acid binding

	Biological Process
GO:0008285	negative regulation of cell population proliferation
GO:0015909	long-chain fatty acid transport
GO:0032365	intracellular lipid transport
GO:0042632	cholesterol homeostasis
GO:0046320	regulation of fatty acid oxidation
GO:0050873	brown fat cell differentiation
GO:0055091	phospholipid homeostasis
GO:0071073	positive regulation of phospholipid biosynthetic process
GO:0140214	positive regulation of long-chain fatty acid import into cell
GO:2001245	regulation of phosphatidylcholine biosynthetic process

External links

PDB	RCSB:3wbg, PDBe:3wbg, PDBj:3wbg
PDBsum	3wbg
PubMed	24121341
UniProt	P05413\|FABPH_HUMAN Fatty acid-binding protein, heart (Gene Name=FABP3)