Structure of PDB 3waa Chain C

Receptor sequence
>3waaC (length=107) Species: 9606 (Homo sapiens) [Search protein sequence]
AKAVSRSQRAGLQFPVGRIHRHLKTRTTSHGRVGATAAVYSAAILEYLTA
EVLELAGNASKDLKVKRITPRHLQLAIRGDEELDSLIKATIAGGGVIPHI
HKSLIGK
3D structure
PDB3waa Structural polymorphism in the L1 loop regions of human H2A.Z.1 and H2A.Z.2
ChainC
Resolution3.2 Å
3D
structure
[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]
Enzymatic activity
Enzyme Commision number ?
Interaction with ligand
Site
#		 Ligand Ligand
chain		 Binding residues on receptor
(original residue number in PDB)		 Binding residues on receptor
(residue number reindexed from 1)		 Binding affinity
BS01 dna C S18 R19 R34 K77 S5 R6 R21 K64
BS02 dna C R31 K37 R45 V46 V78 K79 R80 R18 K24 R32 V33 V65 K66 R67
Gene Ontology
Molecular Function
GO:0003674 molecular_function
GO:0003677 DNA binding
GO:0030527 structural constituent of chromatin
GO:0031492 nucleosomal DNA binding
GO:0046982 protein heterodimerization activity
GO:0060090 molecular adaptor activity
Biological Process
GO:0006325 chromatin organization
GO:0008150 biological_process
GO:0031507 heterochromatin formation
Cellular Component
GO:0000786 nucleosome
GO:0005634 nucleus
GO:0005694 chromosome
GO:0070062 extracellular exosome

View graph for
Molecular Function
View graph for
Biological Process
View graph for
Cellular Component
External links
PDB RCSB:3waa, PDBe:3waa, PDBj:3waa
PDBsum3waa
PubMed24311584
UniProtQ71UI9|H2AV_HUMAN Histone H2A.V (Gene Name=H2AZ2)

[Back to BioLiP]