Structure of PDB 3w9t Chain C

Receptor sequence

>3w9tC (length=432) Species: 40245 (Cucumaria echinata) [Search protein sequence]

QVLCTNPLDIGELRSFKSKQCVDIVGNQGSGNIATYDCDGLSDQQIIICG
DGTIRNEARNYCFTPDGSGNANVMSSPCTLYPEIPSSQRWRQGRRKTFTD
NGGIEQVATEIINLASGKCLDIEGSDGTGDIGVYDCQNLDDQYFYVRSRG
PELFYGRLRNEKSDLCLDVEGSDGKGNVLMYSCEDNLDQWFRYYENGEIV
NAKSGMCLDVEGSDGSGNVGIYRCDDLRDQMWSRPNAYCNGDYCSFLNKE
SNKCLDVSGDQGTGDVGTWQCDGLPDQRFKWVFDDWEVPTATWNMVGCDQ
NGKVSQQISNTISFSSTVTAGVAVEVSSTIEKGVIFAKATVSVKVTASLS
KAWTNSQSGTTAITYTCDNYDSDEEFTRGCMWQLAIETTEVKSGDLLVWN
PQIVKCTRSNTAPGCAPFTKCANEDCTFCTDI

3D structure

PDB

3w9t Hemolytic lectin CEL-III heptamer reveals its transmembrane pore-formation mechanism

Chain

Resolution

2.9 Å

3D
structure

[Spin on]
[Spin off]
[Reset orientation]

[High quality]
[Low quality]

[White background]
[Black background]

[Download]
[Download structure with residue number starting from 1]

Enzymatic activity

Enzyme Commision number

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)
BS01	GAL	C	D23 I24 V25 G26 Y36	D23 I24 V25 G26 Y36
BS02	GAL	C	D121 I122 E123 G124 Y134 Q137	D121 I122 E123 G124 Y134 Q137
BS03	GAL	C	D168 E170 G171 Y181 E184	D168 E170 G171 Y181 E184
BS04	GAL	C	D209 V210 G212 Y222	D209 V210 G212 Y222
BS05	GAL	C	D256 V257 G259 W269	D256 V257 G259 W269
BS06	CA	C	D256 V257 G259 D276	D256 V257 G259 D276
BS07	CA	C	D168 V169 G171 D188	D168 V169 G171 D188
BS08	CA	C	D23 I24 G26 D43	D23 I24 G26 D43
BS09	CA	C	D121 I122 G124 D141	D121 I122 G124 D141
BS10	CA	C	D209 V210 G212 D229	D209 V210 G212 D229
BS11	MG	C	N177 V178 N218 V219 D265 V266	N177 V178 N218 V219 D265 V266
BS12	MG	C	N32 I33 N72 V73 D130 I131	N32 I33 N72 V73 D130 I131

Gene Ontology

	Molecular Function
GO:0000287	magnesium ion binding
GO:0004653	polypeptide N-acetylgalactosaminyltransferase activity
GO:0005509	calcium ion binding
GO:0005534	galactose binding
GO:0030246	carbohydrate binding
GO:0030395	lactose binding
GO:0042806	fucose binding
GO:0046871	N-acetylgalactosamine binding
GO:0046872	metal ion binding
GO:1903777	melibiose binding

	Biological Process
GO:0001906	cell killing
GO:0006493	protein O-linked glycosylation
GO:0019731	antibacterial humoral response
GO:0031640	killing of cells of another organism
GO:0034120	positive regulation of erythrocyte aggregation
GO:0042742	defense response to bacterium
GO:0044179	hemolysis in another organism
GO:0050829	defense response to Gram-negative bacterium
GO:0050830	defense response to Gram-positive bacterium
GO:0051260	protein homooligomerization
GO:0051673	disruption of plasma membrane integrity in another organism

	Cellular Component
GO:0005576	extracellular region
GO:0005615	extracellular space
GO:0005794	Golgi apparatus

View graph for
Molecular Function

View graph for
Biological Process

View graph for
Cellular Component

External links

PDB	RCSB:3w9t, PDBe:3w9t, PDBj:3w9t
PDBsum	3w9t
PubMed
UniProt	Q868M7\|CEL3_CUCEC Galactose/N-acetylgalactosamine-binding lectin CEL-III (Gene Name=cel3)

[Back to BioLiP]