Structure of PDB 3w0t Chain C

Receptor sequence

>3w0tC (length=176) Species: 9606 (Homo sapiens)

GGLTDEAALSCCSDADPSTKDFLLQQTMLRVKDPKKSLDFYTRVLGMTLI
QKCDFPIMKFSLYFLAYEDKNDIPKEKDEKIAWALSRKATLELTHNWGTE
DDETQSYHNGNSDPRGFGHIGIAVPDVYSACKRFEELGVKFVKKPDDGKM
KGLAFIQDPDGYWIEILNPNKMATLM

3D structure

• PDB: 3w0t N-Hydroxypyridone-based glyoxalase I inhibitors mimicking binding interactions of the substrate
• Chain: C
• Resolution: 1.351 Å

Enzymatic activity

• Catalytic site (original residue number in PDB): Q33 E99 H126 E172
• Catalytic site (residue number reindexed from 1): Q26 E92 H119 E165
• Enzyme Commision number: 4.4.1.5: lactoylglutathione lyase.

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	ZN	C	Q33 E99	Q26 E92
BS02	HPU	C	H126 E172 M179 M183	H119 E165 M172 M176
BS03	ZN	C	H126 E172	H119 E165
BS04	HPU	C	Q33 F62 L69 F71 L92 E99	Q26 F55 L62 F64 L85 E92

Gene Ontology

Molecular Function

• GO:0004462 lactoylglutathione lyase activity
• GO:0005515 protein binding
• GO:0008270 zinc ion binding
• GO:0016829 lyase activity
• GO:0046872 metal ion binding

Biological Process

• GO:0005975 carbohydrate metabolic process
• GO:0006357 regulation of transcription by RNA polymerase II
• GO:0006749 glutathione metabolic process
• GO:0009438 methylglyoxal metabolic process
• GO:0030316 osteoclast differentiation
• GO:0043066 negative regulation of apoptotic process

Cellular Component

• GO:0005654 nucleoplasm
• GO:0005737 cytoplasm
• GO:0005829 cytosol
• GO:0005886 plasma membrane
• GO:0070062 extracellular exosome

External links

• PDB: RCSB:3w0t, PDBe:3w0t, PDBj:3w0t
• PDBsum: 3w0t
• UniProt: Q04760|LGUL_HUMAN Lactoylglutathione lyase (Gene Name=GLO1)