Structure of PDB 3vvk Chain C

Receptor sequence

>3vvkC (length=259) Species: 2257 (Natronomonas pharaonis)

EVTQRELFEFVLNDPLLASSLYINIALAGLSILLFVFMTRGLDDPRAKLI
AVSTILVPVVSIASYTGLASGLTISVLEMPAGHFAEGSSVMLGGEEVDGV
VTMWGRYLTWALSTPMILLALGLLAGSNATKLFTAITFDIAMCVTGLAAA
LTTSSHLMRWFWYAISCACFIVVLYILLVEWAQDAKAAGTADIFSTLKLL
TVVMWLGYPIVWALGVEGVAVLPVGYTSWAYSALDIVAKYIFAFLLLNYL
TSNEGVVSG

3D structure

• PDB: 3vvk Large deformation of helix F during the photoreaction cycle of Pharaonis halorhodopsin in complex with azide
• Chain: C
• Resolution: 2.3 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	RET	C	W127 T131 M159 Y180 S183 C184 F187 W222 Y225 P226 W229 K256	W110 T114 M142 Y163 S166 C167 F170 W205 Y208 P209 W212 K239
BS02	22B	C	T151 F155 I193	T134 F138 I176
BS03	RET	C	W127 T131 M159 Y180 S183 C184 F187 W222 Y225 P226 W229 D252 K256	W110 T114 M142 Y163 S166 C167 F170 W205 Y208 P209 W212 D235 K239
BS04	AZI	C	S78 T126 S130 K256	S61 T109 S113 K239

Gene Ontology

Molecular Function

• GO:0005216 monoatomic ion channel activity
• GO:0009881 photoreceptor activity

Biological Process

• GO:0006811 monoatomic ion transport
• GO:0007602 phototransduction
• GO:0034220 monoatomic ion transmembrane transport

Cellular Component

• GO:0005886 plasma membrane
• GO:0016020 membrane

External links

• PDB: RCSB:3vvk, PDBe:3vvk, PDBj:3vvk
• PDBsum: 3vvk
• PubMed: 23442859
• UniProt: P15647|BACH_NATPH Halorhodopsin (Gene Name=hop)