Structure of PDB 3vhi Chain C

Receptor sequence

>3vhiC (length=122) Species: 9031 (Gallus gallus)

RKCSLTGKWTNDLGSNMTIGAVNSRGEFTGTYITAVTATSNEIKESPLHG
TQNTINKRTQPTFGFTVNWKFSESTTVFTGQCFIDRNGKEVLKTMWLLRS
SVNDIGDDWKATRVGINIFTRL

3D structure

• PDB: 3vhi Rational development of caged-biotin protein-labeling agents and some applications in live cells
• Chain: C
• Resolution: 1.76 Å

Interaction with ligand

Site #	Ligand	Ligand chain	Binding residues on receptor (original residue number in PDB)	Binding residues on receptor (residue number reindexed from 1)	Binding affinity
BS01	VHI	C	N12 L14 S16 Y33 T35 V37 T38 W70 F72 S75 T77 W97 I117 N118	N11 L13 S15 Y32 T34 V36 T37 W69 F71 S74 T76 W96 I116 N117	MOAD: Ka=2300000M^-1

Gene Ontology

Molecular Function

• GO:0009374 biotin binding

Biological Process

• GO:0019731 antibacterial humoral response

Cellular Component

• GO:0005576 extracellular region

External links

• PDB: RCSB:3vhi, PDBe:3vhi, PDBj:3vhi
• PDBsum: 3vhi
• PubMed: 22035795
• UniProt: P02701|AVID_CHICK Avidin (Gene Name=AVD)